CDK4 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9606
Artikelname: CDK4 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9606
Hersteller Artikelnummer: P9606
Alternativnummer: ABN-P9606-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CDK4 (P11802, 1 a.a. - 303 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 1019
Puffer: In 10mM Bis-Tris Propane pH9.0 (50% Glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIG
Target-Kategorie: CDK4
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.