CDKN1C (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9612
Artikelname: CDKN1C (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9612
Hersteller Artikelnummer: P9612
Alternativnummer: ABN-P9612-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CDKN1C (P42773, 1 a.a. - 168 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 1031
Puffer: In 20mM Tris-HCl pH 8.0 (2 mM DTT, 200 mM NaCl and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Target-Kategorie: CDKN2C
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.