CDKN1C (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9612
- Bilder (0)
Artikelname: | CDKN1C (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9612 |
Hersteller Artikelnummer: | P9612 |
Alternativnummer: | ABN-P9612-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CDKN1C (P42773, 1 a.a. - 168 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 1031 |
Puffer: | In 20mM Tris-HCl pH 8.0 (2 mM DTT, 200 mM NaCl and 10% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSHMAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
Target-Kategorie: | CDKN2C |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |