BCDIN3D (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9616
- Bilder (0)
Artikelname: | BCDIN3D (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9616 |
Hersteller Artikelnummer: | P9616 |
Alternativnummer: | ABN-P9616-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human BCDIN3D (Q7Z5W3, 1 a.a. - 292 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 144233 |
Puffer: | In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.2 M NaCl, 2 mM EDTA and 40% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSMAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMP |
Target-Kategorie: | BCDIN3D |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |