SVBP (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9617
- Bilder (0)
Artikelname: | SVBP (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9617 |
Hersteller Artikelnummer: | P9617 |
Alternativnummer: | ABN-P9617-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human SVBP (Q8N300, 1 a.a. - 66 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 374969 |
Puffer: | In PBS pH 7.4 (1 mM DTT and 20% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSEFMDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE |
Target-Kategorie: | CCDC23 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |