SVBP (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9617
Artikelname: SVBP (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9617
Hersteller Artikelnummer: P9617
Alternativnummer: ABN-P9617-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human SVBP (Q8N300, 1 a.a. - 66 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 374969
Puffer: In PBS pH 7.4 (1 mM DTT and 20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSEFMDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
Target-Kategorie: CCDC23
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.