CDKN2AIPNL (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9624
Artikelname: CDKN2AIPNL (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9624
Hersteller Artikelnummer: P9624
Alternativnummer: ABN-P9624-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CDKN2AIPNL (Q96HQ2, 1 a.a. - 116 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 91368
Puffer: In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSMVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
Target-Kategorie: CDKN2AIPNL
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.