CDKN2AIPNL (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9624
- Bilder (0)
Artikelname: | CDKN2AIPNL (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9624 |
Hersteller Artikelnummer: | P9624 |
Alternativnummer: | ABN-P9624-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CDKN2AIPNL (Q96HQ2, 1 a.a. - 116 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 91368 |
Puffer: | In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 20% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSMVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS |
Target-Kategorie: | CDKN2AIPNL |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |