CDK5RAP3 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9625
Artikelname: CDK5RAP3 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9625
Hersteller Artikelnummer: P9625
Alternativnummer: ABN-P9625-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CDK5RAP3 (Q96JB5, 1 a.a. - 506 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 80279
Puffer: In PBS pH 7.4 (1 mM DTT and 20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRG
Target-Kategorie: CDK5RAP3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.