Cd14 (Mouse) Recombinant Protein, Insect

Artikelnummer: ABN-P9630
Artikelname: Cd14 (Mouse) Recombinant Protein, Insect
Artikelnummer: ABN-P9630
Hersteller Artikelnummer: P9630
Alternativnummer: ABN-P9630-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Mouse Cd14 (P10810, 16 a.a - 366 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 12475
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWP
Target-Kategorie: Cd14
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.