CD1D (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9634
Artikelname: CD1D (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9634
Hersteller Artikelnummer: P9634
Alternativnummer: ABN-P9634-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD1D (P15813, 20 a.a. - 301 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 912
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGE
Target-Kategorie: CD1D
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.