CD3D (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9639
Artikelname: CD3D (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9639
Hersteller Artikelnummer: P9639
Alternativnummer: ABN-P9639-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD3D (P04234, 22 a.a. - 105 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
Tag: hIgG-His
UniProt: 915
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVALEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN
Target-Kategorie: CD3D
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.