CD3G (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9640
Artikelname: CD3G (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9640
Hersteller Artikelnummer: P9640
Alternativnummer: ABN-P9640-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD3G (P09693, 23 a.a. - 116 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 917
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISHHHHHH
Target-Kategorie: CD3G
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.