CD5 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9644
Artikelname: CD5 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9644
Hersteller Artikelnummer: P9644
Alternativnummer: ABN-P9644-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD5 (P06127, 25 a.a. - 372 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 921
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPEFRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPK
Target-Kategorie: CD5
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.