CD8B (Human) Recombinant Protein

Artikelnummer: ABN-P9652
Artikelname: CD8B (Human) Recombinant Protein
Artikelnummer: ABN-P9652
Hersteller Artikelnummer: P9652
Alternativnummer: ABN-P9652-20
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
UniProt: 926
Puffer: In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
Target-Kategorie: CD8B
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.