BTLA (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9653
Artikelname: BTLA (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9653
Hersteller Artikelnummer: P9653
Alternativnummer: ABN-P9653-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human BTLA (Q7Z6A9, 31 a.a. - 157 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 151888
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYSHHHHHH
Target-Kategorie: BTLA
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.