Cd80 (Mouse) Recombinant Protein, Insect

Artikelnummer: ABN-P9654
Artikelname: Cd80 (Mouse) Recombinant Protein, Insect
Artikelnummer: ABN-P9654
Hersteller Artikelnummer: P9654
Alternativnummer: ABN-P9654-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Mouse Cd80 (Q00609, 37 a.a. - 246 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 12519
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: DVDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNHHHHHH
Target-Kategorie: Cd80
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.