CD9 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9655
- Bilder (0)
Artikelname: | CD9 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9655 |
Hersteller Artikelnummer: | P9655 |
Alternativnummer: | ABN-P9655-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 928 |
Puffer: | In PBS pH 7.4 (1 mM DTT and 20% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI |
Target-Kategorie: | CD9 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |