CD9 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9655
Artikelname: CD9 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9655
Hersteller Artikelnummer: P9655
Alternativnummer: ABN-P9655-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 928
Puffer: In PBS pH 7.4 (1 mM DTT and 20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Target-Kategorie: CD9
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.