CD9 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9656
Artikelname: CD9 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9656
Hersteller Artikelnummer: P9656
Alternativnummer: ABN-P9656-20
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
Tag: hIgG-His
UniProt: 928
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHILEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEW
Target-Kategorie: CD9
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.