CD47 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9666
Artikelname: CD47 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9666
Hersteller Artikelnummer: P9666
Alternativnummer: ABN-P9666-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CD47 (Q08722, 19 a.a. - 141 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
Tag: hIgG-His
UniProt: 961
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNELEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP
Target-Kategorie: CD47
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.