CD244 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9671
Artikelname: CD244 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9671
Hersteller Artikelnummer: P9671
Alternativnummer: ABN-P9671-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 51744
Puffer: In 20mM Tris-HCl pH 8.0 (0.4 M Urea)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWP
Target-Kategorie: CD244
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.