CD247 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9673
Artikelname: CD247 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9673
Hersteller Artikelnummer: P9673
Alternativnummer: ABN-P9673-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD247 (P20963, 52 a.a. - 164 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 919
Puffer: In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Target-Kategorie: CD247
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.