CD247 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9674
Artikelname: CD247 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9674
Hersteller Artikelnummer: P9674
Alternativnummer: ABN-P9674-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD247 (P20963, 52 a.a. - 164 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 919
Puffer: In 20mM Tris-HCl pH 6.8 (1 mM DTT, 0.1 M NaCl, 1 mM EDAT and 50% glycerol)
Formulierung: Liquid
Sequenz: ADPRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRHHHHHH
Target-Kategorie: CD247
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.