CD247 (Human) Recombinant Protein, Insect
Artikelnummer:
ABN-P9674
- Bilder (0)
Artikelname: | CD247 (Human) Recombinant Protein, Insect |
Artikelnummer: | ABN-P9674 |
Hersteller Artikelnummer: | P9674 |
Alternativnummer: | ABN-P9674-5 |
Hersteller: | Abnova |
Wirt: | Insect |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CD247 (P20963, 52 a.a. - 164 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
Tag: | His |
UniProt: | 919 |
Puffer: | In 20mM Tris-HCl pH 6.8 (1 mM DTT, 0.1 M NaCl, 1 mM EDAT and 50% glycerol) |
Formulierung: | Liquid |
Sequenz: | ADPRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRHHHHHH |
Target-Kategorie: | CD247 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |