CD74 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9679
Artikelname: CD74 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9679
Hersteller Artikelnummer: P9679
Alternativnummer: ABN-P9679-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD74 (P04233, 73 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 972
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPMHHHHHH
Target-Kategorie: CD74
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.