Cd276 (Mouse) Recombinant Protein, Insect

Artikelnummer: ABN-P9684
Artikelname: Cd276 (Mouse) Recombinant Protein, Insect
Artikelnummer: ABN-P9684
Hersteller Artikelnummer: P9684
Alternativnummer: ABN-P9684-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Mouse Cd276 (Q8VE98, 29 a.a. - 248 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 102657
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEAHHHHHH
Target-Kategorie: Cd276
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.