CD300C (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9685
- Bilder (0)
Artikelname: | CD300C (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9685 |
Hersteller Artikelnummer: | P9685 |
Alternativnummer: | ABN-P9685-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CD300C (Q08708, 21 a.a. - 183 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 10871 |
Puffer: | In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR |
Target-Kategorie: | CD300C |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |