CD300C (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9686
Artikelname: CD300C (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9686
Hersteller Artikelnummer: P9686
Alternativnummer: ABN-P9686-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD300C (Q08708, 21 a.a. - 183 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 10871
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: MTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRLEHHHHHH
Target-Kategorie: CD300C
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.