CD34 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9691
- Bilder (0)
Artikelname: | CD34 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9691 |
Hersteller Artikelnummer: | P9691 |
Alternativnummer: | ABN-P9691-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CD34 (P28906, 32 a.a. - 290 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 947 |
Puffer: | In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.1 M NaCl and 20% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQ |
Target-Kategorie: | CD34 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |