CD34 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9692
Artikelname: CD34 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9692
Hersteller Artikelnummer: P9692
Alternativnummer: ABN-P9692-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD34 (P28906, 32 a.a. - 290 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 947
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADLSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVAS
Target-Kategorie: CD34
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.