CD34 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9693
Artikelname: CD34 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9693
Hersteller Artikelnummer: P9693
Alternativnummer: ABN-P9693-5
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD34 (P28906, 1 a.a. - 385 a.a.) full recombinant protein expressed in Escherichia coli.
UniProt: 947
Puffer: In 20mM Tris-HCl pH 7.5 (10 mM L-glutathione (reduced))
Formulierung: Liquid
Sequenz: MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEIS
Target-Kategorie: CD34
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.