FGL2 (Human) Recombinant Protein

Artikelnummer: ABN-P9697
Artikelname: FGL2 (Human) Recombinant Protein
Artikelnummer: ABN-P9697
Hersteller Artikelnummer: P9697
Alternativnummer: ABN-P9697-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: ELISA, FA, SDS-PAGE
Spezies Reaktivität: Human
Human FGL2 (Q14314, 205 a.a. - 439 a.a.) partial recombinant protein with hFc-Flag tag at N-terminus expressed in HEK293 cells.
Tag: hFc-Flag
UniProt: 10875
Puffer: In PBS pH 7.4 (200mM Arginine)
Formulierung: Liquid
Sequenz: VQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Target-Kategorie: FGL2
Application Verdünnung: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.
Immobilized Human FGL2, hFc Tag at 1 ug/mL (100 uL/Well) on the plate. Dose response curve for Bio
The purity of Human FGL2 is greater than 90%as determined by SEC-HPLC.
Human FGL2 on Tris-Bis PAGE under reduced condition. The purity is greater than 90%.