DLL3 (Human) Recombinant Protein
Artikelnummer:
ABN-P9698
- Bilder (3)
Artikelname: | DLL3 (Human) Recombinant Protein |
Artikelnummer: | ABN-P9698 |
Hersteller Artikelnummer: | P9698 |
Alternativnummer: | ABN-P9698-100 |
Hersteller: | Abnova |
Wirt: | Human |
Kategorie: | Proteine/Peptide |
Applikation: | ELISA, FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human DLL3 (Q9NYJ7-1, 311 a.a. - 479 a.a.) partial recombinant protein with His tag and Avi tag at C-terminus expressed in HEK293 cells. |
Tag: | His-Avi |
UniProt: | 10683 |
Puffer: | In PBS pH 7.4 |
Formulierung: | Liquid |
Sequenz: | VSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAA |
Target-Kategorie: | DLL3 |
Application Verdünnung: | Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user. |