RAET1L (Human) Recombinant Protein

Artikelnummer: ABN-P9710
Artikelname: RAET1L (Human) Recombinant Protein
Artikelnummer: ABN-P9710
Hersteller Artikelnummer: P9710
Alternativnummer: ABN-P9710-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: ELISA, FA, SDS-PAGE
Spezies Reaktivität: Human
Human RAET1L (Q5VY80, 26 a.a. - 218 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 154064
Puffer: In PBS pH 7.4
Formulierung: Liquid
Sequenz: RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSG
Target-Kategorie: RAET1L
Application Verdünnung: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.