CD7 (Human) Recombinant Protein
Artikelnummer:
ABN-P9719
- Bilder (3)
Artikelname: | CD7 (Human) Recombinant Protein |
Artikelnummer: | ABN-P9719 |
Hersteller Artikelnummer: | P9719 |
Alternativnummer: | ABN-P9719-100 |
Hersteller: | Abnova |
Wirt: | Human |
Kategorie: | Proteine/Peptide |
Applikation: | ELISA, FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human CD7 (P09564, 26 a.a. - 180 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells. |
Tag: | hFc |
UniProt: | 924 |
Puffer: | Lyophilized from sterile distilled Water is > 100 ug/mL |
Formulierung: | Lyophilized |
Sequenz: | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
Target-Kategorie: | CD7 |
Application Verdünnung: | Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user. |