GPC3 (Human) Recombinant Protein

Artikelnummer: ABN-P9727
Artikelname: GPC3 (Human) Recombinant Protein
Artikelnummer: ABN-P9727
Hersteller Artikelnummer: P9727
Alternativnummer: ABN-P9727-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: ELISA, FA, SDS-PAGE
Spezies Reaktivität: Human
Human GPC3 (P51654-1, 438 a.a. - 554 a.a.) partial recombinant protein expressed in HEK293 cells.
UniProt: 2719
Puffer: In PBS pH 7.4
Formulierung: Liquid
Sequenz: RNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN
Target-Kategorie: GPC3
Application Verdünnung: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.