TNFSF12 (Human) Recombinant Protein

Artikelnummer: ABN-P9729
Artikelname: TNFSF12 (Human) Recombinant Protein
Artikelnummer: ABN-P9729
Hersteller Artikelnummer: P9729
Alternativnummer: ABN-P9729-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: ELISA, FA, SBR, SDS-PAGE
Spezies Reaktivität: Human
Human TNFSF12 (O43508-1, 43 a.a. - 249 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 8742
Puffer: In PBS pH 7.4
Formulierung: Liquid
Sequenz: SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Target-Kategorie: TNFSF12
Application Verdünnung: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.