IGHE (Human) Recombinant Protein

Artikelnummer: ABN-P9730
Artikelname: IGHE (Human) Recombinant Protein
Artikelnummer: ABN-P9730
Hersteller Artikelnummer: P9730
Alternativnummer: ABN-P9730-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: ELISA, FA, SDS-PAGE
Spezies Reaktivität: Human
Human IGHE (P01854, 209 a.a. - 428 a.a.) partial recombinant protein with His and Avi tag at C-terminus expressed in HEK293 cells.
Tag: His-Avi
UniProt: 3497
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: CADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGL
Target-Kategorie: IGHE
Application Verdünnung: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.
Immobilized Human IgE, His Tag at 0.5 ug/mL (100 uL/well) on the plate. Dose response curve for Ant
The purity of Human IgE is greater than 95% as determined by SEC-HPLC.
Human IgE on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.