NRP1 (Human) Recombinant Protein

Artikelnummer: ABN-P9739
Artikelname: NRP1 (Human) Recombinant Protein
Artikelnummer: ABN-P9739
Hersteller Artikelnummer: P9739
Alternativnummer: ABN-P9739-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: ELISA, FA, SDS-PAGE
Spezies Reaktivität: Human
Human NRP1 (NP_001019799.1, 22 a.a. - 644 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 8829
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKC
Target-Kategorie: NRP1
Application Verdünnung: Biological ActivityELISASDS-PAGEThe optimal working dilution should be determined by the end user.
Immobilized Human VEGF165, No Tag at 5 ug/mL (100 uL/well) on the plate. Dose res
The purity of Human Neuropilin-1 is greater than 95% as determined by SEC-HPLC.
Human Neuropilin-1 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.