IGSF11 (Human) Recombinant Protein

Artikelnummer: ABN-P9740
Artikelname: IGSF11 (Human) Recombinant Protein
Artikelnummer: ABN-P9740
Hersteller Artikelnummer: P9740
Alternativnummer: ABN-P9740-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SBR, SDS-PAGE
Spezies Reaktivität: Human
Human IGSF11 (Q5DX21-1, 23 a.a. - 241 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 152404
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
Target-Kategorie: IGSF11
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.
Human B7-H5, hFc Tag captured on CM5 Chip via Protein A can bind Human IGSF11, His Tag with a
The purity of Human IGSF11 is greater than 95% as determined by SEC-HPLC.
Human IGSF11 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.