IGSF11 (Human) Recombinant Protein
Artikelnummer:
ABN-P9740
- Bilder (3)
Artikelname: | IGSF11 (Human) Recombinant Protein |
Artikelnummer: | ABN-P9740 |
Hersteller Artikelnummer: | P9740 |
Alternativnummer: | ABN-P9740-100 |
Hersteller: | Abnova |
Wirt: | Human |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SBR, SDS-PAGE |
Spezies Reaktivität: | Human |
Human IGSF11 (Q5DX21-1, 23 a.a. - 241 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells. |
Tag: | His |
UniProt: | 152404 |
Puffer: | Lyophilized from sterile distilled Water is > 100 ug/mL |
Formulierung: | Lyophilized |
Sequenz: | LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG |
Target-Kategorie: | IGSF11 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |