BTN2A1 (Human) Recombinant Protein

Artikelnummer: ABN-P9741
Artikelname: BTN2A1 (Human) Recombinant Protein
Artikelnummer: ABN-P9741
Hersteller Artikelnummer: P9741
Alternativnummer: ABN-P9741-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SBR, SDS-PAGE
Spezies Reaktivität: Human
Human BTN2A1 (Q7KYR7-1, 29 a.a. - 248 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 11120
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: QFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPLA
Target-Kategorie: BTN2A1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.
Human BTN2A1, His Tag immobilized on CM5 Chip can bind Human CD209, His Tag with an affinity
The purity of Human BTN2A1 is greater than 95% as determined by SEC-HPLC.
Human BTN2A1 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.