BTN2A1 (Human) Recombinant Protein
Artikelnummer:
ABN-P9741
- Bilder (3)
Artikelname: | BTN2A1 (Human) Recombinant Protein |
Artikelnummer: | ABN-P9741 |
Hersteller Artikelnummer: | P9741 |
Alternativnummer: | ABN-P9741-100 |
Hersteller: | Abnova |
Wirt: | Human |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SBR, SDS-PAGE |
Spezies Reaktivität: | Human |
Human BTN2A1 (Q7KYR7-1, 29 a.a. - 248 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells. |
Tag: | His |
UniProt: | 11120 |
Puffer: | Lyophilized from sterile distilled Water is > 100 ug/mL |
Formulierung: | Lyophilized |
Sequenz: | QFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPLA |
Target-Kategorie: | BTN2A1 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |