IL2RG (Human) Recombinant Protein
Artikelnummer:
ABN-P9743
- Bilder (3)
Artikelname: | IL2RG (Human) Recombinant Protein |
Artikelnummer: | ABN-P9743 |
Hersteller Artikelnummer: | P9743 |
Alternativnummer: | ABN-P9743-100 |
Hersteller: | Abnova |
Wirt: | Human |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SBR, SDS-PAGE |
Spezies Reaktivität: | Human |
Human IL2RG (P31785-1, 27 a.a. - 239 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells. |
Tag: | hFc |
UniProt: | 3561 |
Puffer: | Lyophilized from sterile distilled Water is > 100 ug/mL |
Formulierung: | Lyophilized |
Sequenz: | LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
Target-Kategorie: | IL2RG |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |