LGR5 (Human) Recombinant Protein

Artikelnummer: ABN-P9744
Artikelname: LGR5 (Human) Recombinant Protein
Artikelnummer: ABN-P9744
Hersteller Artikelnummer: P9744
Alternativnummer: ABN-P9744-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SBR, SDS-PAGE
Spezies Reaktivität: Human
Human LGR5 (O75473-1, 22 a.a. - 543 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Tag: hFc
UniProt: 8549
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEK
Target-Kategorie: LGR5
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.
Human LGR-5, hFc Tag captured on CM5 Chip via Protein A can bind Human R-Spondin 3, His Tag wit
The purity of Human LGR-5 is greater than 95% as determined by SEC-HPLC.
Human LGR-5 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.