Scrib polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB15708
Artikelname: Scrib polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB15708
Hersteller Artikelnummer: PAB15708
Alternativnummer: ABN-PAB15708-50
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant GST fusion protein corresponding to 143 mouse Scrib.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against partial recombinant Scrib.
UniProt: 105782
Puffer: In PBS (50% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: ALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS
Target-Kategorie: Scrib
Application Verdünnung: Western Blot (1:1000)The optimal working dilution should be determined by the end user.