Pdcd11 polyclonal antibody, Rabbit
Artikelnummer:
ABN-PAB15709
| Artikelname: |
Pdcd11 polyclonal antibody, Rabbit |
| Artikelnummer: |
ABN-PAB15709 |
| Hersteller Artikelnummer: |
PAB15709 |
| Alternativnummer: |
ABN-PAB15709-50 |
| Hersteller: |
Abnova |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
Recombinant GST fusion protein corresponding to a 170 amino acid fragment of mouse Pdcd11. |
| Alternative Synonym: |
ABN-202409-10_Ab |
| Rabbit polyclonal antibody raised against partial recombinant Pdcd11. |
| UniProt: |
18572 |
| Puffer: |
In PBS (50% glycerol, 0.02% sodium azide). |
| Formulierung: |
Liquid |
| Sequenz: |
TKSEKYKEAGELYNRMLKRFRQEKAVWIKYGAFVLGRSQAGASHRVLQRALECLPAKEHVDVIVKFAQLEFQLGDVERAKAIFENTLSTYPKRTDVWSVYIDMTIKHGSQTAVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALEYVEAKSSALED |
| Target-Kategorie: |
Pdcd11 |
| Application Verdünnung: |
Western Blot (1:1000)The optimal working dilution should be determined by the end user. |
