Astn1 polyclonal antibody, Rabbit
Artikelnummer:
ABN-PAB15713
Artikelname: |
Astn1 polyclonal antibody, Rabbit |
Artikelnummer: |
ABN-PAB15713 |
Hersteller Artikelnummer: |
PAB15713 |
Alternativnummer: |
ABN-PAB15713-50 |
Hersteller: |
Abnova |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Mouse |
Immunogen: |
Recombinant GST fusion protein corresponding to 103 mouse Astn1. |
Alternative Synonym: |
ABN-202409-10_Ab |
Rabbit polyclonal antibody raised against partial recombinant Astn1. |
UniProt: |
11899 |
Puffer: |
In PBS (50% glycerol, 0.02% sodium azide) |
Formulierung: |
Liquid |
Sequenz: |
LYHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRGSLKYLGCRYSEIKPYGLDWSELSRDLRKTCEEQTLSVPYNDYGDSKDI |
Target-Kategorie: |
Astn1 |
Application Verdünnung: |
Western Blot (1:1000)The optimal working dilution should be determined by the end user. |