Zfp292 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB15720
Artikelname: Zfp292 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB15720
Hersteller Artikelnummer: PAB15720
Alternativnummer: ABN-PAB15720-50
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant GST fusion protein corresponding to 136 mouse Zfp292.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against partial recombinant Zfp292.
UniProt: 30046
Puffer: In PBS (50% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: PMGFEASFLKFLEESAVKQKKNSDRDHSNSGSKRGSHSSSRRHVDKAAVAGSSHVCSCKDSEIFVQFANPSKLQCSENVKIVLDKTLKDRSELVLKQLQEMKPTVSLKKLEVLSNNPDRTVLKEISIGKATGRGQY
Target-Kategorie: Zfp292
Application Verdünnung: Western Blot (1:1000)The optimal working dilution should be determined by the end user.