Morc2a polyclonal antibody, Rabbit
Artikelnummer:
ABN-PAB15729
| Artikelname: |
Morc2a polyclonal antibody, Rabbit |
| Artikelnummer: |
ABN-PAB15729 |
| Hersteller Artikelnummer: |
PAB15729 |
| Alternativnummer: |
ABN-PAB15729-50 |
| Hersteller: |
Abnova |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
Recombinant GST fusion protein corresponding to 240 mouse Morc2a. |
| Alternative Synonym: |
ABN-202409-10_Ab |
| Rabbit polyclonal antibody raised against partial recombinant Morc2a. |
| UniProt: |
74522 |
| Puffer: |
In PBS (50% glycerol, 0.02% sodium azide) |
| Formulierung: |
Liquid |
| Sequenz: |
KDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRNCLRYFLPPSFPISKKELSVMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD |
| Target-Kategorie: |
Morc2a |
| Application Verdünnung: |
Western Blot (1:1000)The optimal working dilution should be determined by the end user. |
