MUM1L1 polyclonal antibody, Rabbit
Artikelnummer:
ABN-PAB19956
| Artikelname: |
MUM1L1 polyclonal antibody, Rabbit |
| Artikelnummer: |
ABN-PAB19956 |
| Hersteller Artikelnummer: |
PAB19956 |
| Alternativnummer: |
ABN-PAB19956-100 |
| Hersteller: |
Abnova |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC-P |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant protein corresponding to amino acids 91-201 of human MUM1L1. |
| Alternative Synonym: |
ABN-202409-10_Ab |
| Rabbit polyclonal antibody raised against recombinant MUM1L1. |
| UniProt: |
139221 |
| Puffer: |
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Formulierung: |
Liquid |
| Sequenz: |
KVALGILNERTNLSQASTSDEEEITMLSQNVPQKQSDSPPHKKYRKDEGDLPGCLEERENSACLLASSESDDSLYDDKSQAPTMVDTIPSEVETKSLQNSSWCETFPSLSE |
| Target-Kategorie: |
MUM1L1 |
| Application Verdünnung: |
Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user. |
