CKAP4 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB19963
Artikelname: CKAP4 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB19963
Hersteller Artikelnummer: PAB19963
Alternativnummer: ABN-PAB19963-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids 411-520 of human CKAP4.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CKAP4.
UniProt: 10970
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
Target-Kategorie: CKAP4
Application Verdünnung: ImmunohistochemistryThe optimal working dilution should be determined by the end user.