CLCC1 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20646
Artikelname: CLCC1 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20646
Hersteller Artikelnummer: PAB20646
Alternativnummer: ABN-PAB20646-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human CLCC1.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant CLCC1.
UniProt: 23155
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLL
Target-Kategorie: CLCC1
Application Verdünnung: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.