LRRC70 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20656
Artikelname: LRRC70 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20656
Hersteller Artikelnummer: PAB20656
Alternativnummer: ABN-PAB20656-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human LRRC70.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant LRRC70.
UniProt: 100130733
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: PLSSLIHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVKSPHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQIQL
Target-Kategorie: LRRC70
Application Verdünnung: Immunohistochemistry (1:10-1:20)The optimal working dilution should be determined by the end user.