TMEM204 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20687
Artikelname: TMEM204 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20687
Hersteller Artikelnummer: PAB20687
Alternativnummer: ABN-PAB20687-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human TMEM204.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant TMEM204.
UniProt: 79652
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
Target-Kategorie: TMEM204
Application Verdünnung: Immunohistochemistry (1:50-1:200)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.