TMCC3 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB20704
Artikelname: TMCC3 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB20704
Hersteller Artikelnummer: PAB20704
Alternativnummer: ABN-PAB20704-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human TMCC3.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant TMCC3.
UniProt: 57458
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVILEELREIKDTQAQLAEDIEALKVQFKREYGFISQTLQEERYRYERLE
Target-Kategorie: TMCC3
Application Verdünnung: Immunohistochemistry (1:50-1:200)The optimal working dilution should be determined by the end user.